General Information

  • ID:  hor003334
  • Uniprot ID:  Q91259(102-121)
  • Protein name:  MSH-B
  • Gene name:  POM
  • Organism:  Petromyzon marinus (Sea lamprey)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Petromyzon (genus), Petromyzontidae (family), Petromyzontiformes (order), Hyperoartia (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VQESADGYRMQHFRWGQPLP
  • Length:  20(102-121)
  • Propeptide:  MATTSSAPTRSSSLPCRVALLLSGLIALLGPAASRSAPLVCLQACESCLEPAQPEPLCWMQCLGECSRLAAPSADGSEIVLLGGGGGDEAPEGGEVSADKRVQESADGYRMQHFRWGQPLPGKKRQPEQSQGVPLGMGSDENARVVNGGQAWDEGWTLDDQANEVNARQWSAAPSKKDSTPLSMQKENPELYQMNHFRWGQPPTHFKQKRYGGFMRKSPGYAHLKPLVTFFRDVMKNDSPTMLNN
  • Signal peptide:  MATTSSAPTRSSSLPCRVALLLSGLIALLGPAAS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the adrenal glands to release cortisol.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q91259-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003334_AF2.pdbhor003334_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 274175 Formula: C107H156N32O30S
Absent amino acids: CIKNT Common amino acids: Q
pI: 7.54 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 5
Hydrophobicity: -111 Boman Index: -4988
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 4557.5 Extinction Coefficient cystines: 6990
Absorbance 280nm: 367.89

Literature

  • PubMed ID:  8537171
  • Title:  Isolation and Characterization of Melanotropins From Lamprey Pituitary Glands